Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310879 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-WSC Domain Containing 2 (WSCD2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-WSCD2 antibody: synthetic peptide directed towards the C terminal of human WSCD2
- Description
- Protein A purified
- Reactivity
- Human, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAAL
KGRNL TGVPDDYYPR- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 1998 Oct 30;5(5):277-86
DNA research : an international journal for rapid publication of reports on genes and genomes 1998 Oct 30;5(5):277-86
No comments: Submit comment
No validations: Submit validation data