HPA013346

WSCD2 antibody from Sigma-Aldrich
KIAA0789
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013346
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013346, RRID:AB_1858865
Product name
Anti-WSCD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013346
Antibody type
Polyclonal
Antigen
WSC domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAELSFLGDMHLGRGFRDTGEASSIARRYGPWFKG
KDGNERAKLGDYGGAWSRALKGRVVREKEEERAKY
IGCYLDDTQSRALRGVSFFDYKKMTIFRCQDNCAE
RGYLY
Storage
-20C
Provider Type Product Number
- No reagents -