WH0006860M4

SYT4 antibody from Sigma-Aldrich
HsT1192, KIAA1342
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0006860M4
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0006860M4, RRID:AB_1843833
Product name
Monoclonal Anti-SYT4 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0006860M4
Antibody type
Monoclonal
Antigen
SYT4 (NP_065834, a.a. 1-100) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAW
ICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSK
KKFGADDKNEVKNKPAVPKNSLHLDLEKR* (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -