H00006860-M04A

SYT4 antibody from Abnova Corporation
HsT1192, KIAA1342

Antibody data

Product number
H00006860-M04A
Provider
Abnova Corporation
Product name
SYT4 monoclonal antibody (M04A), clone 5F8
Provider product page
Abnova Corporation - H00006860-M04A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SYT4.
Antigen sequence
MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAW
ICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSK
KKFGADDKNEVKNKPAVPKNSLHLDLEKR
Isotype
IgG
Antibody clone number
5F8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -