HPA010574

SYT4 antibody from Atlas Antibodies
HsT1192, KIAA1342
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010574
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010574, RRID:AB_2668309
Product name
Anti-SYT4
Provider product page
Atlas Antibodies - HPA010574
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKN
EVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGS
PSDLENATPKLFLEGEKESVSPESLKSSTSLTSEE
KQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMD
EQSMT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -