WH0011044M1

TENT4A antibody from MilliporeSigma / Merck KGaA
LAK-1, PAPD7, POLK, POLS, TRF4, TRF4-1
ELISA
Recommended by provider

Antibody data

Product number
WH0011044M1
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-POLS antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0011044M1
Antibody type
Monoclonal
Antigen
POLS (NP_008930, a.a. 2-111) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGS
FSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKH
NVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFN
METG* (without GST)
Isotype
IgG
Storage
-20C