HPA017045

CLCA4 antibody from Sigma-Aldrich
CaCC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017045
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017045, RRID:AB_2291679
Product name
Anti-CLCA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017045
Antibody type
Polyclonal
Antigen
Calcium-activated chloride channel regulator 4 precursor (Calcium-activated chloride channel family member 4) (CaCC-4) (Calcium-activated chloride channel protein 2) (CaCC-2)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WVGMVHFDSTATIVNKLIQIKSSDERNTLMAGLPT
YPLGGTSICSGIKYAFQVIGELHSQLDGSEVLLLT
DGEDNTASSCIDEV
Storage
-20C
Provider Type Product Number
- No reagents -