HPA017045

CLCA4 antibody from Atlas Antibodies
CaCC2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017045
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017045, RRID:AB_2291679
Product name
Anti-CLCA4
Provider product page
Atlas Antibodies - HPA017045
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WVGMVHFDSTATIVNKLIQIKSSDERNTLMAGLPT
YPLGGTSICSGIKYAFQVIGELHSQLDGSEVLLLT
DGEDNTASSCIDEV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -