H00051258-M09

MRPL51 antibody from Abnova Corporation
bMRP64, CDA09, HSPC241, MRP64
No application information provided.

Antibody data

Product number
H00051258-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051258-M09, RRID:AB_1577434
Product name
MRPL51 monoclonal antibody (M09), clone 1H5
Provider product page
Abnova Corporation - H00051258-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MRPL51.
Antigen sequence
MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIR
LTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHP
KELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFAD
DLHNLNKRIRYLYKHFNRHGKFR
Isotype
IgG
Antibody clone number
1H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -