HPA036947

antibody from Atlas Antibodies

Targeting: NCAPD2 CAP-D2, CNAP1, hCAP-D2, KIAA0159

Antibody data

Submit

Validation data

Product number: HPA036947 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036947, RRID:AB_10671367
Product name: Anti-NCAPD2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DKSVLVCKNAIQLLASFLANNPFSCKLSDADLAGP LQKETQKLQEMRAQRRTAAASAVLDPEEEWEAMLP ELKSTLQQLLQLPQGEEEIPEQIA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NCAPD2 protein structure - HPA036947 shown in red.

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting NCAPD2 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting NCAPD2 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:58
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Prod no: s19233
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Prod no 2: s19235
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 3: s228544
KD Reagent Page 3: KD Reagent Page 3
Antibody Lot Number: R33514
Appendix: 560e27efaee75.pdf

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NCAPD2 antibody. Remaining relative intensity is presented.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line NTERA-2