HPA010587

TIMM21 antibody from Sigma-Aldrich
C18orf55, HSPC154, TIM21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010587
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010587, RRID:AB_1851244
Product name
Anti-C18orf55 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010587
Antibody type
Polyclonal
Antigen
TIM21-like protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPS
LRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKA
KEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRD
Storage
-20C
Provider Type Product Number
- No reagents -