HPA055652

NOP14 antibody from Atlas Antibodies
C4orf9, NOL14, RES4-25, UTP2

Antibody data

Product number
HPA055652
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055652, RRID:AB_2682876
Product name
Anti-NOP14
Provider product page
Atlas Antibodies - HPA055652
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQELCQSTLTEMESQKQLCRPLTCEKSKPVPLKLF
TPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFK
GAVREIRKDNQFLARMQLSEIMER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -