H00008602-B01P

NOP14 antibody from Abnova Corporation
C4orf9, NOL14, RES4-25, UTP2

Antibody data

Product number
H00008602-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008602-B01P, RRID:AB_10553029
Product name
NOP14 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00008602-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NOP14 protein.
Antigen sequence
MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVK
VNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTL
LKEYKERDKSNVFRDKRFGEYNSNMSPEEKMMKRF
ALEQQRHHEKKSIYNLNEDEELTHYGQSLADIEKH
NDIVDSDSDAEDRGTLSAELTAAHFGGGGGLLHKK
TQQEGEEREKPKSRKELIEELIAKSKQEKRERQAQ
REDALELTEKLDQDWKEIQTLLSHKTPKSENRDKK
EKPKPDAYDMMVRELGFEMKAQPSNRMKTEAELAK
EEQEHLRKLEAERLRRMLGKDEDENVKKPKHMSAD
DLNDGFVLDKDDRRLLSYKDGKMNVEEDVQEEQSK
EASDPESNEEEGDSSGGEDTEESDSPDSHLDLESN
VESEEENEKPAKEQRQTPGKGLISGKERAGKATRD
ELPYTFAAPESYEELRSLLLGRSMEEQLLVVERIQ
KCNHPSLAEGNKAKLEKLFGFLLEYVGDLATDDPP
DLTVIDKLVVHLYHLCQMFPESASDAIKFVLRDAM
HEMEEMIETKGRAALPGLDVLIYLKITGLLFPTSD
FWHPVVTPALVCLSQLLTKCPILSLQDVVKGLFVC
CLFLEYVALSQRFIPELINFLLGILYIATPNKASQ
GSTLVHPFRALGKNSELLVVSAREDVATWQQSSLS
LRWASRLRAPTSTEANHIRLSCLAVGLALLKRCVL
MYGSLPSFHAIMGPLQALLTDHLADCSHPQELQEL
CQSTLTEMESQKQLCRPLTCEKSKPVPLKLFTPRL
VSNSRPQVIHLPWPPNYRCEPQHPAKKVIFFRVIM
L
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -