SAB1400316

NOP14 antibody from Sigma-Aldrich
C4orf9, NOL14, RES4-25, UTP2
ELISA
Recommended by provider

Antibody data

Product number
SAB1400316
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400316, RRID:AB_1845720
Product name
Anti-C4orf9 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400316
Antibody type
Polyclonal
Antigen
C4orf9 (AAH26035, a.a. 1-806) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVK
VNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTL
LKEYKERDKSNVFRDKRFGEYNSNMSPEEKMMKRF
ALEQQRHHEKKSIYNLNEDEELTHYGQSLADIEKH
NDIVDSDSDAEDRGTLSAELTAAHFGGGGGLLHKK
TQQEGEEREKPKSRKELIEELIAKSKQEKRERQAQ
REDALELTEKLDQDWKEIQTLLSHKTPKSENRDKK
EKPKPDAYDMMVRELGFEMKAQPSNRMKTEAELAK
EEQEHLRKLEAERLRRMLGKDEDENVKKPKHMSAD
DLNDGFVLDKDDRRLLSYKDGKMNVEEDVQEEQSK
EASDPESNEEEGDSSGGEDTEESDSPDSHLDLESN
VESEEENEKPAKEQRQTPGKGLISGKERAGKATRD
ELPYTFAAPESYEELRSLLLGRSMEEQLLVVERIQ
Storage
-20C
Provider Type Product Number
- No reagents -