PAB22577

EPG5 antibody from Abnova Corporation
hEPG5, KIAA1632

Antibody data

Product number
PAB22577
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22577, RRID:AB_10966031
Product name
EPG5 polyclonal antibody
Provider product page
Abnova Corporation - PAB22577
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant EPG5.
Antigen sequence
VGRELLGTITAVHPEIISVLLDRVQETIDQVGMVS
LYLFKELPLYLWQPSASEIAVIRDWLLNYNLTVVK
NKLACVILEGLNWGFAKQATLHLDQAVHAEVALMV
LEAYQKYLAQKPYAGILSESMKQV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -