HPA031689

EPG5 antibody from Sigma-Aldrich
hEPG5, KIAA1632
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031689
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA031689, RRID:AB_10609997
Product name
Anti-KIAA1632 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA031689
Antibody type
Polyclonal
Antigen
KIAA1632 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGRELLGTITAVHPEIISVLLDRVQETIDQVGMVS
LYLFKELPLYLWQPSASEIAVIRDWLLNYNLTVVK
NKLACVILEGLNWGFAKQATLHLDQAVHAEVALMV
LEAYQKYLAQKPYAGILSESMKQV
Storage
-20C
Provider Type Product Number
- No reagents -