HPA010588

GLT8D1 antibody from Sigma-Aldrich
AD-017, FLJ14611
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010588
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010588, RRID:AB_1078098
Product name
Anti-GLT8D1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010588
Antibody type
Polyclonal
Antigen
glycosyltransferase 8 domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAIN
SIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKS
IRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARF
YLPILVPSAKKAIYMDDDVIVQG
Storage
-20C
Provider Type Product Number
- No reagents -