HPA074513

ATPSCKMT antibody from Atlas Antibodies
FAM173B, JS-2

Antibody data

Product number
HPA074513
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA074513, RRID:AB_2686698
Product name
Anti-FAM173B
Provider product page
Atlas Antibodies - HPA074513
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRG
SLVDIGSGDGRIVIAAAKKGFTAVGY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -