AV53473

ATPSCKMT antibody from Sigma-Aldrich
FAM173B, JS-2
No application information provided.

Antibody data

Product number
AV53473
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV53473, RRID:AB_1853002
Product name
Anti-LOC134145 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV53473
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human LOC134145 with an internal ID of P31994
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNW
GFLLTGLVGGTLVAV
Storage
-20C
Provider Type Product Number
- No reagents -