ABIN635205

antibody from antibodies-online

Targeting: RHBDF1 C16orf8, Dist1, EGFR-RS, FLJ2235, iRhom1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN635205 - Provider product page
Provider: antibodies-online
Product name: anti-Rhomboid 5 Homolog 1 (Drosophila) (RHBDF1) antibody
Antibody type: Polyclonal
Antigen: RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

RHBDF1 protein structure - ABIN635205 shown in red.