HPA015527

RHBDF1 antibody from MilliporeSigma / Merck KGaA
C16orf8, Dist1, EGFR-RS, FLJ2235, iRhom1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015527
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015527, RRID:AB_10602244
Product name
Anti-RHBDF1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015527
Antibody type
Polyclonal
Antigen
rhomboid 5 homolog 1 (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PWLKLDIPSAVPLTAEEPSFLQVGPGLQGLWVPPV
QYPHHDPVAQPLRRQAFLRSVSMPAETAHISSPHH
ELRRPVLQRQTSITQTIR
Storage
-20C
Provider Type Product Number
- No reagents -