HPA010592

antibody from Atlas Antibodies

Targeting: CD74 DHLAG

Western blot

Antibody data

Submit

Validation data

Product number: HPA010592 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA010592, RRID:AB_1078482
Product name: Anti-CD74
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYG NMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLK NTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDA PPK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CD74 protein structure - HPA010592 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using HPA010592 antibody. Corresponding CD74 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows strong granular cytoplasmic positivity.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong membranous and cytoplasmic positivity in germinal center cells and in non-germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Sample type: HUMAN