HPA010592

CD74 antibody from Sigma-Aldrich
DHLAG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010592
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010592, RRID:AB_1078482
Product name
Anti-CD74 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010592
Antibody type
Polyclonal
Antigen
HLA class II histocompatibility antigen gamma-chain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYG
NMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLK
NTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDA
PPK
Storage
-20C
Provider Type Product Number
- No reagents -