HPA040601

HAUS1 antibody from Atlas Antibodies
CCDC5, FLJ40084, HEI-C, HsT1461
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA040601
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040601, RRID:AB_10794743
Product name
Anti-HAUS1
Provider product page
Atlas Antibodies - HPA040601
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILH
HLSERNRVRDRDVYLVIEDLKQKASEYESEAKYLQ
DLLMESVNFSPANLSSTGSRYLNALVD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -