HPA017311

SPAST antibody from Sigma-Aldrich
ADPSP, FSP2, KIAA1083, SPG4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017311
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017311, RRID:AB_1857415
Product name
Anti-SPAST antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017311
Antibody type
Polyclonal
Antigen
Spastin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPS
YSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPST
PTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTA
VKFDDIAGQDLAKQALQEIVILPSLRPELFTGL
Storage
-20C
Provider Type Product Number
- No reagents -