H00147339-B01P

C18orf25 antibody from Abnova Corporation
Ark2N, ARKL1, MGC12909, RNF111L1
No application information provided.

Antibody data

Product number
H00147339-B01P
Provider
Abnova Corporation
Product name
C18orf25 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00147339-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C18orf25 protein.
Antigen sequence
MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSV
ELESQVQKDGVADSTVISSMPCLLMELRRDSSESQ
LASTESDKPTTGRVYESDSSNHCMLSPSSSGHLAD
SDTLSSAEENEPSQAETAVEGDPSGVSGATVGRKS
RRSRSESETSTMAAKKNRQSSDKQNGRVAKVKGHR
SQKHKERIRLLRQKREAAARKKYNLLQDSSTSDSD
LTCDSSTSSSDDDEEVSGSSKTITAEIPDGPPVVA
HYDMSDTNSDPEVVNVDNLLAAAVVQEHSNSVGGQ
DTGATWRTSGLLEELNAEAGHLDPGFLASDKTSAG
NAPLNEEINIASSDSEVEIVGVQEHARCVHPRGGV
IQSVSSWKHGSGTQYVSTRQTQSWTAVTPQQTWAS
PAEVVDLTLDEDSRRKYLL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -