HPA051314

C18orf25 antibody from Atlas Antibodies
Ark2N, ARKL1, MGC12909, RNF111L1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA051314
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051314, RRID:AB_2681438
Product name
Anti-C18orf25
Provider product page
Atlas Antibodies - HPA051314
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGH
LADSDTLSSAEENEPSQAETAVEGDPSGVSGATVG
RKSRRSRSESETSTMA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -