Antibody data

Product number
HPA017604
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017604, RRID:AB_2669625
Product name
Anti-KRTAP24-1
Provider product page
Atlas Antibodies - HPA017604
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSMSTTGYPGVCSTTSYRTHCYIPVTSSVTLSSSD
LSPTFGHCLPSSYQGNLWLLDYCQESYGEAPTCKS
PS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.