PAB22541

KRTAP24-1 antibody from Abnova Corporation
KAP24.1
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
PAB22541
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22541, RRID:AB_10965344
Product name
KRTAP24-1 polyclonal antibody
Provider product page
Abnova Corporation - PAB22541
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human KRTAP24-1.
Description
Rabbit polyclonal antibody raised against recombinant KRTAP24-1.
Reactivity
Human
Host
Rabbit
Antigen sequence
YQNPCFIPSYVSPLCYISNSCQPQSYLVRNYHYSS
YRPTSCRPLSYLSRSFRSLSYIPSTF
Isotype
IgG
Vial size
100 μL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.