HPA031325

KRTAP24-1 antibody from MilliporeSigma / Merck KGaA
KAP24.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031325
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-KRTAP24-1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031325
Antibody type
Polyclonal
Antigen
keratin associated protein 24-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YQNPCFIPSYVSPLCYISNSCQPQSYLVRNYHYSS
YRPTSCRPLSYLSRSFRSLSYIPSTF
Storage
-20C