WH0010299M2

MARCHF6 antibody from MilliporeSigma / Merck KGaA
MARCH-VI, MARCH6, RNF176, TEB4
ELISA
Recommended by provider

Antibody data

Product number
WH0010299M2
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0010299M2, RRID:AB_1842380
Product name
Monoclonal Anti-MARCH6 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0010299M2
Antibody type
Monoclonal
Antigen
MARCH6 (NP_005876, a.a. 2-92) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIH
QECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPS
RLPIQDIFAGLVTSIGTAIR* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -