HPA063246

MARCHF6 antibody from Atlas Antibodies
MARCH-VI, MARCH6, RNF176, TEB4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA063246
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA063246, RRID:AB_2684970
Product name
Anti-MARCH6
Provider product page
Atlas Antibodies - HPA063246
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAA
DQPANPPAENAVVGENPDAQDDQAEEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -