H00010299-A01

MARCHF6 antibody from Abnova Corporation
MARCH-VI, MARCH6, RNF176, TEB4

Antibody data

Product number
H00010299-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010299-A01, RRID:AB_463083
Product name
MARCH6 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00010299-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant MARCH6.
Antigen sequence
DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIH
QECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPS
RLPIQDIFAGLVTSIGTAIR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -