HPA040841

MARCHF6 antibody from Atlas Antibodies
MARCH-VI, MARCH6, RNF176, TEB4

Antibody data

Product number
HPA040841
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040841, RRID:AB_2677162
Product name
Anti-MARCH6
Provider product page
Atlas Antibodies - HPA040841
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HTRQWLKGLVRAWTVTAGYLLDLHSYLLGDQEENE
NSANQQVNNNQHARNNNAIPVVGEGLHAAHQAILQ
QGGPVGFQPYRRPLN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -