HPA008557

GRAMD1B antibody from Atlas Antibodies
KIAA1201, LINC01059
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008557
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008557, RRID:AB_1079197
Product name
Anti-GRAMD1B
Provider product page
Atlas Antibodies - HPA008557
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPK
EKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPT
DEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSK
LL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -