HPA008557

GRAMD1B antibody from Sigma-Aldrich
KIAA1201
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008557
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008557, RRID:AB_1079197
Product name
Anti-GRAMD1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008557
Antibody type
Polyclonal
Antigen
GRAM domain containing 1B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPK
EKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPT
DEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSK
LL
Storage
-20C
Provider Type Product Number
- No reagents -