H00140258-M01

KRTAP13-1 antibody from Abnova Corporation
KAP13.1
No application information provided.

Antibody data

Product number
H00140258-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00140258-M01, RRID:AB_1204602
Product name
KRTAP13-1 monoclonal antibody (M01), clone 2A1
Provider product page
Abnova Corporation - H00140258-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KRTAP13-1.
Antigen sequence
WHANSESSQCNSAELTSPINMSYNCCSGNFSSRSC
GGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGS
SLYRGCQQTCWEPTSCQTSYVESSPCQTS
Isotype
IgG
Antibody clone number
2A1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -