HPA012565

BTN3A1 antibody from Sigma-Aldrich
BT3.1, BTF5, BTN3.1, CD277
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012565
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012565, RRID:AB_1845494
Product name
Anti-BTN3A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012565
Antibody type
Polyclonal
Antigen
Butyrophilin subfamily 3 member A1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQY
ASRGERHSAYNEWKKALFKPADVILDPKTANPILL
Storage
-20C
Provider Type Product Number
- No reagents -