HPA041830

antibody from Atlas Antibodies

Targeting: ROPN1L ASP, FLJ25776, RSPH11

Antibody data

Submit

Validation data

Product number: HPA041830 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041830, RRID:AB_2677695
Product name: Anti-ROPN1L
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADV LRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTG LTQGLL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ROPN1L protein structure - HPA041830 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and prostate tissues using Anti-ROPN1L antibody. Corresponding ROPN1L RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, fallopian tube, liver and testis using Anti-ROPN1L antibody HPA041830 (A) shows similar protein distribution across tissues to independent antibody HPA039193 (B).
Antibody #2 product nr: HPA039193
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ROPN1L antibody HPA041830.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube using Anti-ROPN1L antibody HPA041830.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ROPN1L antibody HPA041830.
Sample type: HUMAN