H00083853-B01

ROPN1L antibody from Abnova Corporation
ASP, FLJ25776, RSPH11

Antibody data

Product number
H00083853-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083853-B01, RRID:AB_1204923
Product name
ROPN1L MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00083853-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ROPN1L protein.
Antigen sequence
MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQP
ADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKT
DTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLC
LPKEKFKALLQLDPCENKIKWINFLALGCSMLGGS
LNTALKHLCEILTDDREGGPARIPFKTFSYVYRYL
ARLDSDVSPLETESYLASLKENIDARKNGMIGLSD
FFFPKRKLLESIENSEDVGH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -