Antibody data

Product number
H00011342-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011342-M02, RRID:AB_1137422
Product name
RNF13 monoclonal antibody (M02), clone 3E4
Provider product page
Abnova Corporation - H00011342-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RNF13.
Antigen sequence
LPARFGYRLPAEGLKGFLINSKPENACEPIVPPPV
KDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAI
VHNVDSDDLISMGSNDIEVLKKIDIPSVFI
Isotype
IgG
Antibody clone number
3E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -