Antibody data

Product number
ABIN404921
Provider
antibodies-online
Product name
anti-Ring Finger Protein 13 (RNF13) antibody
Provider product page
antibodies-online - ABIN404921
Antibody type
Polyclonal
Antigen
The immunogen for anti-RNF13 antibody: synthetic peptide directed towards the N terminal of human RNF13
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
ILAYNFENASQTFDDLPARFGYRLPAEGLKGFLIN
SKPEN ACEPIVPPPV
Vial size
50 µg
Provider Type Product Number
- No reagents -