HPA008709

RNF13 antibody from Sigma-Aldrich
RZF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008709
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008709, RRID:AB_1079823
Product name
Anti-RNF13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008709
Antibody type
Polyclonal
Antigen
RING finger protein 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGD
SDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGAL
SESRSHQNMTESSDYEEDDNEDTDSSDAENE
Storage
-20C
Provider Type Product Number
- No reagents -