SAB2102017

RNF13 antibody from Sigma-Aldrich
RZF
No application information provided.

Antibody data

Product number
SAB2102017
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102017, RRID:AB_10610719
Product name
Anti-RNF13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102017
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_009213.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILAYNFENASQTFDDLPARFGYRLPAEGLKGFLIN
SKPENACEPIVPPPV
Storage
-20C
Provider Type Product Number
- No reagents -