HPA010743

DCT antibody from Atlas Antibodies
TYRP2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010743
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010743, RRID:AB_1847519
Product name
Anti-DCT
Provider product page
Atlas Antibodies - HPA010743
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYN
CGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQ
FLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQ
FANCSVYDF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -