HPA010743

DCT antibody from Sigma-Aldrich
TYRP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010743
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010743, RRID:AB_1847519
Product name
Anti-DCT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010743
Antibody type
Polyclonal
Antigen
L-dopachrome tautomerase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYN
CGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQ
FLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQ
FANCSVYDF
Storage
-20C
Provider Type Product Number
- No reagents -