Antibody data

Product number
HPA010744
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010744, RRID:AB_2668357
Product name
Anti-IGSF9B
Provider product page
Atlas Antibodies - HPA010744
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEAPLSSGKVSPESIRTLRAPSESSDDQGQPAAKR
MLSPTREKELSLYKKTKRAISSKKYSVAKAEAEAE
ATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGF
PFAEETDMYPEFRQSDEENEDPLVPTSVAALKSQL
TPLSSSQE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -