HPA010802

IGSF9B antibody from Sigma-Aldrich
KIAA1030
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010802
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010802, RRID:AB_1079194
Product name
Anti-IGSF9B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010802
Antibody type
Polyclonal
Antigen
CDNA FLJ40259 fis, clone TESTI2025486. recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEAPLSSGKVSPESIRTLRAPSESSDDQGQPAAKR
MLSPTREKELSLYKKTKRAISSKKYSVAKAEAEAE
ATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGF
PFAEETDMYPEFRQSDEENEDPLVPTSVAALKSQL
TPLSSSQE
Storage
-20C
Provider Type Product Number
- No reagents -