HPA059818

HDHD2 antibody from Atlas Antibodies
DKFZP564D1378
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA059818
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA059818, RRID:AB_2684132
Product name
Anti-HDHD2
Provider product page
Atlas Antibodies - HPA059818
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDI
SEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDF
KG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -