HPA010803

FAM234B antibody from Sigma-Aldrich
KIAA1467
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010803
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010803, RRID:AB_1079200
Product name
Anti-KIAA1467 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010803
Antibody type
Polyclonal
Antigen
KIAA1467 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVSR
PAANLVCLSGMNGSTLWSSLLPEEARDITCLELMP
GSLAETICLVTGTHKMLSAFNATSGKAIWTLNPNY
LSNGTLAAPVVVLPDLDEDGVR
Storage
-20C
Provider Type Product Number
- No reagents -